Staphylococcus aureus CA-347 (MRSA): CA347_1148 Help Entry CA347_1148        CDS       T02702                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sauc  Staphylococcus aureus CA-347 (MRSA) Pathway sauc00998   Biosynthesis of various antibiotics sauc01100   Metabolic pathways sauc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sauc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CA347_1148 (acpP)    00074 Mycolic acid biosynthesis     CA347_1148 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CA347_1148 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AGO29501 LinkDB All DBs Position 1213545..1213778 Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKFINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaatttcgataaagtaaaagatatcatcgttgaccgtttaggtgtagacgctgat aaagtaactgaagatgcatctttcaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagacgagtttggtactgaaattcctgatgaagaagctgaa aaaatcaacactgttggtgatgctgttaaatttattaacagtcttgaaaaataa

DBGET integrated database retrieval system