Staphylococcus aureus 502A: CH52_12925 Help Entry CH52_12925        CDS       T03491                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saud  Staphylococcus aureus 502A Pathway saud00998   Biosynthesis of various antibiotics saud01100   Metabolic pathways saud01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saud00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CH52_12925    00074 Mycolic acid biosynthesis     CH52_12925   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CH52_12925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AHM71148 UniProt:  A0A0D1JMR1 LinkDB All DBs Position complement(2674445..2674678) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKFINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaatttcgataaagtaaaagatatcatcgttgaccgtttaggtgtagacgctgat aaagtaactgaagatgcatctttcaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagatgagtttggtactgaaattcctgatgaagaagctgaa aaaatcaacactgttggtgatgctgttaaatttattaacagtcttgaaaaataa

DBGET integrated database retrieval system