Streptomyces auratus: SU9_004820 Help Entry SU9_004820        CDS       T07630                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sauh  Streptomyces auratus Pathway sauh00998   Biosynthesis of various antibiotics sauh01100   Metabolic pathways sauh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sauh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SU9_004820    00074 Mycolic acid biosynthesis     SU9_004820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SU9_004820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QTZ95916 UniProt:  A0A8B1NZV1 LinkDB All DBs Position complement(1179213..1179488) Genome browser AA seq 91 aa AA seqDB search MFDEITGMLRAVLDDQGLDEVEMVRDTRFHDDLDLESIDLVTLGGQLAARYGERVNFAEF LAGLELEEIIYLTIGQLVDYVVGCLRQTGEC NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgttcgacgagatcaccggaatgctgcgggccgtgctcgacgatcaggggctggacgag gtcgagatggtccgggacacccggttccacgacgacctggacctggagagcatcgatctg gtcaccctcggcggccagttggcggcgcggtacggggagcgggtgaacttcgccgagttc ctcgccggcctcgaactcgaagagatcatctacctcaccatcggccaactcgtggactac gtggtcggctgcctgcgccagacgggagagtgctga

DBGET integrated database retrieval system