Streptomyces auratus: SU9_009955 Help Entry SU9_009955        CDS       T07630                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sauh  Streptomyces auratus Pathway sauh00998   Biosynthesis of various antibiotics sauh01100   Metabolic pathways sauh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sauh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SU9_009955    00074 Mycolic acid biosynthesis     SU9_009955   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SU9_009955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QTZ91764 UniProt:  J1ZTE2 LinkDB All DBs Position 2351242..2351490 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQVDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKHQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccaggtggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagacggtcggcgacgcgaccgactacatcctcaagcac cagagctga

DBGET integrated database retrieval system