Streptomyces auratus: SU9_026990 Help Entry SU9_026990        CDS       T07630                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sauh  Streptomyces auratus Pathway sauh00998   Biosynthesis of various antibiotics sauh01100   Metabolic pathways sauh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sauh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SU9_026990    00074 Mycolic acid biosynthesis     SU9_026990   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SU9_026990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5930 Motif Other DBs NCBI-ProteinID:  QTZ94644 UniProt:  J2A238 LinkDB All DBs Position complement(6183846..6184112) Genome browser AA seq 88 aa AA seqDB search MERSSVISAVEKSLSAVLERPVTGLTEELRLFEDLHLDSTSVLELLMELEDATEISVDPE DLDMDDFKSVGSLTDYVLSQTAQTTGEG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaacgcagcagcgtgatctcggcggtggaaaagtccctcagcgcggtactggagcgc cccgtcaccggtctcaccgaggagctacgcctattcgaggacctgcatctggactcgacg tccgtcctggaactgctgatggaactggaggacgccacagaaatctcggtggaccccgag gacctggacatggacgacttcaagtcggtcggatcgctcaccgactacgtcctgtcccag accgcgcagaccaccggcgagggatga

DBGET integrated database retrieval system