Staphylococcus auricularis: I6G39_07255 Help Entry I6G39_07255       CDS       T07334                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saul  Staphylococcus auricularis Pathway saul01100   Metabolic pathways saul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6G39_07255    00074 Mycolic acid biosynthesis     I6G39_07255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6G39_07255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  QPT05490 LinkDB All DBs Position complement(1472328..1472561) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKYINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagatatcatcgttgaccgtttaggtgtagatgctgac aaagtaactgaagacgcatctttcaaagatgatctaggcgctgattcacttgatattgct gaattagttatggaattagaagacgaatttggtacagaaattcctgatgaagaagcagaa aaaatcaatactgttggtgacgctgttaaatatatcaacagccttgaaaaataa

DBGET integrated database retrieval system