KEGG   Streptomyces autolyticus: BV401_07565
Entry
BV401_07565       CDS       T04980                                 
Name
(GenBank) cytochrome P450
  KO
K22997  cyclooctat-9-en-7-ol 5-monooxygenase [EC:1.14.99.61]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00997  Biosynthesis of various other secondary metabolites
sauo01100  Metabolic pathways
sauo01110  Biosynthesis of secondary metabolites
Module
sauo_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various other secondary metabolites
    BV401_07565
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.61  cyclooctat-9-en-7-ol 5-monooxygenase
     BV401_07565
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AQA10369
UniProt: A0A1P8XQ66
LinkDB
Position
1979086..1980447
AA seq 453 aa
MTPAKSSAQPERSWTTGTAPGSVPLLGHTLALWRQPLQFLASLPAHGDLVEVRLGPSRAY
LVCHPELVRHVLLNPRTFDKGGVFDKARQLLGNSLSVSRGEEHRSQRRMIQPAFHTPKIS
AYTAAVADDTRAAIGSWEPGRTLDISDTMHALLMRVAARTLFSTGIDEATIDEARHCLRT
VSDGIYKRTMAPLGIMEKLPTPGNRRYDRANARLRQIVDEMIRDRRRSGTDHGDLLSTLL
RAEHPETGKGLDDGEVLDQVVTFLVAGSETTASTLAFVFHLLGAHPEVEKRVHAEIDEVL
EGRVATFEDLPSLEYTRGVITESLRLYPPSWMAMRVTAAETELGGRTIPAGTMILYSAQA
LHHNPELFPDPERFDPERWLPGRAEEVPRGALLPFGAGSHKCIGDVLALTETALIVATIA
SRWRLRPVPGTTLRPEPKATLEPGPLPMVCEPR
NT seq 1362 nt   +upstreamnt  +downstreamnt
gtgactcccgcgaagagctccgcacagccggagcgctcctggaccaccggcacggcgccc
ggctcggtgccgctgctggggcacaccctggcgctctggcgccaaccgctccagttcctg
gcctccctgcccgcccacggcgatctggtggaggtcaggctggggcccagccgcgcctat
ctggtctgccatccggagctggtgcgccatgtgctgctcaacccccgtacgttcgacaag
ggcggggtcttcgacaaggcgcggcagttgctcgggaacagcctctcggtctcccggggc
gaggaacaccgctcccagcggcggatgatccagcccgcgttccacaccccgaagatctcc
gcctacaccgccgcggtcgccgatgacacccgcgccgcgatcggctcctgggagccgggg
cggaccctggacatcagcgacaccatgcacgccctgctgatgcgggtcgccgcgcggacc
ctgttctccaccgggatcgacgaggcgacgatcgacgaggcgcgccactgtctgcgcacc
gtctcggacggcatctacaagcgcaccatggcgcccttggggatcatggagaagctcccg
acgccgggcaaccggcgctacgaccgggccaacgcccggctgcggcagatcgtggacgag
atgatccgcgaccggcggcgctccggcaccgaccacggcgatctgctctccacgctgctg
cgcgccgaacaccccgagaccgggaagggattggacgacggcgaggtcctggaccaggtg
gtcaccttcctggtcgccgggagcgagaccaccgcctccaccctcgccttcgtcttccat
ctcctgggcgcccacccggaggtggagaagcgggtgcacgccgagatcgacgaggtcctc
gagggtcgcgtcgccaccttcgaggacctgccgtccctggagtacacccgcggggtcatc
accgagtcgctgcggctgtacccgccgtcctggatggccatgcgggtcacggcggccgag
accgaactcggcggccggaccatcccggcgggcacgatgatcctctacagcgcccaggcg
ctgcaccacaaccccgaactgttccccgaccccgagcggttcgaccccgagcgctggctc
cccggccgcgccgaggaggtgccgcgcggggcgctgctcccgttcggcgcgggcagccac
aagtgcatcggggacgtcctggcgctgaccgagaccgccctcatcgtggcgacgatcgcg
agccggtggcgtcttcgcccggtgcccgggaccaccttgcgccccgagccgaaggcgacg
ctcgaacccggcccgctgcccatggtgtgcgagccgcgctga

DBGET integrated database retrieval system