Shewanella avicenniae: JYB87_01340 Help Entry JYB87_01340       CDS       T07845                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism savi  Shewanella avicenniae Pathway savi01100   Metabolic pathways savi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:savi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JYB87_01340    00074 Mycolic acid biosynthesis     JYB87_01340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JYB87_01340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSX33928 LinkDB All DBs Position complement(303238..303492) Genome browser AA seq 84 aa AA seqDB search MSLHNEIKQLIIDSLDLEDVTVEDIETDAPLFGEGLGLDSIDALELGLAIKKQFDVKLEA NSAATRDYFYSVASLAKFIESQRA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttacataacgaaattaagcagttgattatcgatagtctcgacctcgaggatgtg acggttgaagacatcgaaactgacgcacccctgtttggtgaaggccttgggttggactct atcgacgcccttgaattggggttggcgattaaaaagcagtttgacgtcaagctggaagcc aactccgctgcgacccgcgactatttttacagcgtggccagtttagccaagtttattgaa tcacaacgtgcgtga

DBGET integrated database retrieval system