Sulfobacillus acidophilus TPY: TPY_1913 Help Entry TPY_1913          CDS       T01576                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism say  Sulfobacillus acidophilus TPY Pathway say03060   Protein export say03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:say00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     TPY_1913  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     TPY_1913  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:say02044]     TPY_1913 Secretion system [BR:say02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    TPY_1913 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AEJ40093 LinkDB All DBs Position complement(1825065..1825271) Genome browser AA seq 68 aa AA seqDB search MFGDLLSPSHLIVLLIIAVFVFGPKRLPELGKGLGQTIRDFKGAVSGTHVAPPEVNPAAA SDSELKDG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgttcggagatttattgtcaccctcccaccttatcgtgttgttgattatcgccgtgttc gtgtttggaccgaaacgtttgccggaactaggtaaggggttgggacagaccattcgtgat ttcaaaggagcggttagcgggacgcacgtggcaccccctgaagtcaatccggcggccgcc tccgactccgaactgaaggacggttag

DBGET integrated database retrieval system