Shewanella amazonensis: Sama_1227 Help Entry Sama_1227         CDS       T00445                                  Name (GenBank) DNA-binding protein, HU family   KO K03530   DNA-binding protein HU-beta Organism saz  Shewanella amazonensis Brite KEGG Orthology (KO) [BR:saz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:saz03032]     Sama_1227    03036 Chromosome and associated proteins [BR:saz03036]     Sama_1227    03400 DNA repair and recombination proteins [BR:saz03400]     Sama_1227 DNA replication proteins [BR:saz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Sama_1227 Chromosome and associated proteins [BR:saz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     Sama_1227 DNA repair and recombination proteins [BR:saz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       Sama_1227 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Peptidase_M35 NTPase_P4 Motif Other DBs NCBI-ProteinID:  ABL99434 UniProt:  A1S4X8 LinkDB All DBs Position 1511088..1511360 Genome browser AA seq 90 aa AA seqDB search MNKSELIEKIASGADISKAAAGRALDSFIAAVTEGLKDGGKISLVGFGTFEVRERAERTG RNPQSGKEIKIPAAKIPAFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatctgaactgatcgagaaaattgcttctggtgccgatatttccaaggctgct gccggtcgcgcactggactctttcatcgctgctgtgactgaaggtctgaaggacggcggt aaaatttccctggttggttttggtacttttgaagttcgtgagcgtgctgagcgtaccggc cgtaacccacagtctggcaaagagatcaaaatccctgctgccaagatcccagcattcaaa gctggtaaagctctgaaagacgcagtcaactaa

DBGET integrated database retrieval system