Shewanella amazonensis: Sama_1979 Help Entry Sama_1979         CDS       T00445                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saz  Shewanella amazonensis Pathway saz01100   Metabolic pathways saz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sama_1979    00074 Mycolic acid biosynthesis     Sama_1979   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sama_1979 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  ABM00185 UniProt:  A1S728 LinkDB All DBs Position complement(2408197..2408430) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVKEEDVKPSASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcatcgttgagcaactgggcgttaaagaa gaagacgttaagccatctgcctctttcgtagacgatctgggtgccgattctctggacact gttgagttggtaatggctctggaagaagagtttgacaccgagatccctgatgaagaagcc gagaagatcaccactgttcaggcagcgatcgactacgtttccaagaatcagtaa

DBGET integrated database retrieval system