Capillimicrobium parvum: DSM104329_02238 Help Entry DSM104329_02238   CDS       T08390                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sbae  Capillimicrobium parvum Pathway sbae01100   Metabolic pathways sbae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSM104329_02238 (acpP_1)    00074 Mycolic acid biosynthesis     DSM104329_02238 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSM104329_02238 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Ribosomal_L50 Diox-like_N Motif Other DBs NCBI-ProteinID:  UGS35841 UniProt:  A0A9E6XXY4 LinkDB All DBs Position 2260821..2261069 Genome browser AA seq 82 aa AA seqDB search MTREDVFQLIRAHLADELEVDPERIRQDTRFKEDLEADSLDLYTLVQELEDSYGVRISDE EATKILTVGQAVDFVMAHGVNA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacccgagaggacgtcttccagctcatccgtgcccacctcgccgacgagctcgaggtg gatccggagcgcatccggcaggacacgcgcttcaaggaggacctcgaggccgactcgctc gacctgtacaccctcgtgcaggagctcgaggactcctacggcgtgcgcatctccgacgag gaggcgacgaagatcctcaccgtgggtcaggcggtggacttcgtcatggcgcacggcgtc aacgcgtag

DBGET integrated database retrieval system