Candidatus Sulfurimonas baltica: HUE88_10455 Help Entry HUE88_10455       CDS       T07552                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sbal  Candidatus Sulfurimonas baltica Brite KEGG Orthology (KO) [BR:sbal00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sbal03032]     HUE88_10455    03036 Chromosome and associated proteins [BR:sbal03036]     HUE88_10455    03400 DNA repair and recombination proteins [BR:sbal03400]     HUE88_10455 DNA replication proteins [BR:sbal03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HUE88_10455 Chromosome and associated proteins [BR:sbal03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HUE88_10455 DNA repair and recombination proteins [BR:sbal03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HUE88_10455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Arm-DNA-bind_4 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QOY51527 UniProt:  A0A7S7LU21 LinkDB All DBs Position 2073919..2074203 Genome browser AA seq 94 aa AA seqDB search MNKAQFVELVQTSGGYKTKVEAEAAIKAFTEAVTAALVKKEDVSLVGFGNFSANLQKGKS GKVPGTDKTYTTQDKMVPKFKAGKGLKDRIAAGK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaataaagctcaattcgttgaactagtacaaacaagtggtggatataaaactaaagtt gaagcagaagcagctataaaagcatttacagaggcggttacggcagctttagtaaaaaaa gaagatgtttctttagtgggatttggtaatttttcagcaaatcttcaaaaaggtaaaagt ggaaaagtacctggtactgataaaacttatactacacaagataaaatggttcctaaattc aaagctggtaaaggtcttaaagaccgtattgcagctggcaaataa

DBGET integrated database retrieval system