Segatella baroniae: L6469_13730 Help Entry L6469_13730       CDS       T09580                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sbao  Segatella baroniae Pathway sbao00020   Citrate cycle (TCA cycle) sbao00720   Other carbon fixation pathways sbao01100   Metabolic pathways sbao01110   Biosynthesis of secondary metabolites sbao01120   Microbial metabolism in diverse environments sbao01200   Carbon metabolism sbao01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:sbao00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L6469_13730   09102 Energy metabolism    00720 Other carbon fixation pathways     L6469_13730 Enzymes [BR:sbao01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L6469_13730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_2 Fer4_6 Fer4_9 Fer4_10 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_15 Fer4_22 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  UKK79412 LinkDB All DBs Position 2:891679..891915 Genome browser AA seq 78 aa AA seqDB search MGIIKGAIVVNTDRCKGCSLCVVACPKNCISIAEKKVNVHGYPYVEPNAQSDSCVGCASC AIVCPDGCITVYRKKTED NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgggaataatcaaaggcgctatcgtcgttaatacagacagatgcaaaggctgtagcctt tgcgttgtagcctgtccgaaaaattgtatttcgatagcggagaaaaaggtaaacgttcac ggttatccttatgttgaacctaatgcacagagtgactcgtgtgtagggtgtgcttcgtgt gctatcgtatgtccagatggatgcataactgtgtatcgtaaaaaaacagaagattaa

DBGET integrated database retrieval system