Sphingobium fuliginis KK22: H5V43_01600 Help Entry H5V43_01600       CDS       T06985                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sbar  Sphingobium fuliginis KK22 Pathway sbar00190   Oxidative phosphorylation sbar01100   Metabolic pathways Module sbar_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sbar00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     H5V43_01600  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sbar00194]     H5V43_01600 Photosynthesis proteins [BR:sbar00194]  Photosystem and electron transport system   F-type ATPase [OT]    H5V43_01600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QOT71900 UniProt:  A0A292ZJL9 LinkDB All DBs Position 1:complement(353554..353808) Genome browser AA seq 84 aa AA seqDB search MALHFELVTPEKLVRSEEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGTIQIFANAGAAPE IIPVRGGFAEVNEKGLTVLAEHAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcactgcatttcgaactcgtgaccccggaaaagctcgtccgctcggaagaggtctat caggtggtcgtccccggcaccgatggcgacttcggcgtgctggagggccatgcgcccttc atgtcgaccgtccgtgacggcacgatccagatcttcgccaacgccggcgccgccccggaa atcatcccggttcgcggcggctttgccgaggtgaacgaaaagggcctcaccgtccttgcg gagcatgccggctga

DBGET integrated database retrieval system