Sphingobium fuliginis KK22: H5V43_03020 Help Entry H5V43_03020       CDS       T06985                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sbar  Sphingobium fuliginis KK22 Pathway sbar01100   Metabolic pathways sbar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H5V43_03020    00074 Mycolic acid biosynthesis     H5V43_03020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H5V43_03020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  QOT72157 UniProt:  A0A292ZFZ1 LinkDB All DBs Position 1:626505..626738 Genome browser AA seq 77 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIDSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaccgcggatcgcgtaaagaaaatcgtcgtcgagcatctgggcgtcgaagcc gaaaaggtgaccgaggatgcgagcttcatcgacgatctgggcgctgacagcctggacatc gttgagttggtgatggcgttcgaggaagaattcggcgtcgaaatccccgacgatgcggcc gagaagatcgccaccgtcaaggatgccatcgattatatcgacagcaagcagtaa

DBGET integrated database retrieval system