KEGG   Sphingobium fuliginis KK22: H5V43_05015
Entry
H5V43_05015       CDS       T06985                                 
Symbol
glgB
Name
(GenBank) 1,4-alpha-glucan branching protein GlgB
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbar  Sphingobium fuliginis KK22
Pathway
sbar00500  Starch and sucrose metabolism
sbar01100  Metabolic pathways
sbar01110  Biosynthesis of secondary metabolites
Module
sbar_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
sbar_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:sbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H5V43_05015 (glgB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbar04147]
    H5V43_05015 (glgB)
Enzymes [BR:sbar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     H5V43_05015 (glgB)
Exosome [BR:sbar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H5V43_05015 (glgB)
SSDB
Motif
Pfam: CBM_48 GlgB_N Alpha-amylase_C Alpha-amylase
Other DBs
NCBI-ProteinID: QOT72500
UniProt: A0A292Z9Z9
LinkDB
Position
1:1066391..1068553
AA seq 720 aa
MGLTPEQIARLLEGREDDPFATLGVHPAEKGFTACVFLPDAVRVDAYRLDGKAASALDRV
HPAGLFFGKVALRKRQPLRYRATYADGGEYTLIDPYSFGPVLGPMDDYYFAEGSHARLFD
KMGAHLITHEGVGGTHFAVWAPNAQRVSVVGDFNRWDGRRAPMRRRQDAGIWEIFLPEVG
VGSAYKYEIVGPDGTVLPLKADPFAFRSELRPATASIVAAVPDHDWGDERHRDYWQRADP
RREPISVYEVHAGSWQRDDDGNFLSWDDLAHRLIPYVVGMGFTHIEFLPISEFPYDPSWG
YQTTGLYAPTARFGDPEGFARFVDGAHRAGVGVILDWVPAHFPTDAHGLAHFDGTALYEH
ADPRKGFHPDWNTAIYNFGRREVAQYLVNNALFWAERYHVDGLRVDAVASMLYLDYSRKE
GEWIPNSQGGRENVEAVDFLRQMNKALYGTHAGVMTIAEESTSWPKVSHPVHEGGLGFGF
KWNMGFMHDTLRYLARDPVHRAHHHDDITFGLLYAFTENFVLALSHDEVVHGKASLLHKM
PGDDWQKFATLRAYYAMMWGYPGKKLLFMGQEFAQRAEWSEARALDWHLLDHAPHRGVQL
LVSDLNRLYRSRPALHARDCEPEGFEWVLVDAAADSVFAWVRRAPGVSPIVVISHFTPTL
RHGYRMRLPSGGRWREIINSDAADYGGSGAGNMGIVVADEEGWANVTIPPLGTLMLELDY
NT seq 2163 nt   +upstreamnt  +downstreamnt
gtgggcttgaccccggaacagatcgcccgcctgctggaggggcgggaggacgatccgttc
gcgacgcttggcgtccatccggcggaaaagggcttcaccgcctgcgtcttcctgcccgat
gcggtgagggtcgatgcttataggctggacggcaaggccgcaagcgcgctggaccgggtc
catccggcagggctgttcttcggcaaggttgccctgcgcaagcgccagcccctgcgctat
cgggcgacctatgccgatggcggcgaatatacgctgatcgatccctacagcttcggcccg
gtgctggggccgatggacgattattattttgccgaagggtctcatgcccggctgttcgac
aagatgggcgcgcacctcatcacccatgaaggggtggggggcacgcatttcgcggtctgg
gcgcccaatgcgcagcgggtgtcggtggtgggcgacttcaaccgctgggacgggcgccgg
gcgccgatgcggcggcggcaggatgcgggaatatgggaaatcttcctgcccgaagtgggg
gtgggcagcgcctataaatatgagattgtcgggcctgacgggacggtcctgccgctgaag
gccgatcccttcgccttccgctccgaactgcggcccgccacggcctccatcgtggcggcg
gtgcccgaccatgactggggcgatgagcgccaccgcgactattggcaaagggccgatccg
cgccgcgaacccatttccgtctatgaggtgcacgccggttcatggcagcgcgacgatgat
ggaaatttcctgagttgggatgaccttgcccaccggctgatcccctatgtggtcggcatg
ggcttcacccatatcgaattcctgccgatcagcgaatttccctatgatcctagctggggc
tatcagaccacgggcctttacgcgccgaccgcgcgctttggcgatccggaaggctttgcc
cgcttcgtcgacggcgcgcaccgggcgggagtgggcgtgatcctcgactgggtgcccgcc
catttcccgaccgacgcccacgggctggcccatttcgacggcaccgccctttatgagcat
gccgatccgcgcaagggcttccatcccgactggaacacggcgatctacaatttcggccgg
cgggaggtggcgcaatatctggtcaacaacgccctcttctgggcggagcgctaccatgtc
gacgggcttcgcgtcgatgccgtcgcctcgatgctctacctcgattacagccgcaaggaa
ggggagtggattcccaacagccagggtgggcgggagaatgtggaggcggtcgatttcctg
cggcagatgaacaaggcgctctacggcacccatgccggcgtcatgaccattgccgaggag
tcgacgagctggccgaaggtgtcccaccccgtccatgaagggggcctgggcttcggtttc
aaatggaatatgggcttcatgcacgacacgctgcgttatctggcgcgcgatccggtgcac
cgcgcccatcatcatgacgacatcaccttcggcctgctctacgcctttacggagaatttc
gtgctggcgctcagccatgacgaggtggtgcatggcaaggcgtccctgctgcacaagatg
ccgggcgacgactggcagaaattcgcgaccctgcgcgcctattacgccatgatgtggggc
tatccgggcaagaagctgctgttcatggggcaggaattcgcgcagcgggccgaatggagc
gaagcgcgggcgctcgactggcacctgctcgatcacgcgccgcatcggggcgtgcagttg
ctggtgagcgacctcaaccgcctctatcgttcccgcccggcgctgcatgcccgcgattgc
gagccggagggtttcgaatgggtgctggtcgacgcggcggcggattcggtcttcgcctgg
gtccggcgcgcgcccggcgtatcgcccatcgtcgtcatcagccacttcacgccgaccttg
cgccacggctacaggatgcgcctgccctccggcggccgctggcgcgagatcatcaacagc
gatgcggcggattatggcggcagcggcgcgggaaatatgggaattgtcgtcgcggatgag
gaaggatgggccaatgtcaccattccgccgcttggaacgttgatgctggaactggactat
tga

DBGET integrated database retrieval system