Sphingobium fuliginis KK22: H5V43_20600 Help Entry H5V43_20600       CDS       T06985                                  Name (GenBank) toluene monooxygenase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism sbar  Sphingobium fuliginis KK22 Pathway sbar00361   Chlorocyclohexane and chlorobenzene degradation sbar00362   Benzoate degradation sbar00623   Toluene degradation sbar01100   Metabolic pathways sbar01120   Microbial metabolism in diverse environments sbar01220   Degradation of aromatic compounds Module sbar_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:sbar00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     H5V43_20600    00361 Chlorocyclohexane and chlorobenzene degradation     H5V43_20600    00623 Toluene degradation     H5V43_20600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  QOT73608 UniProt:  A0A292ZG92 LinkDB All DBs Position 2:complement(1014500..1014751) Genome browser AA seq 83 aa AA seqDB search MAERPQSDILDAKFVRVRNRRENGLIEFDFAIGAPEIFVELLMPTAAFEEFCAVNRVTDV TGQPLEQDDFDARLARVLAGEAR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgaccgcaatccgacatattggacgcgaagttcgtgcgcgtccgcaaccgc cgcgaaaacggcctgatcgaattcgacttcgccatcggcgccccggaaatcttcgtggaa ctgctgatgccgaccgcggcgttcgaggaattctgcgccgtcaaccgcgtgaccgacgtg accggccagccgctggagcaggacgatttcgacgcccggctggcgcgggtgctcgccggc gaagcccgataa

DBGET integrated database retrieval system