Streptomyces bathyalis: G4Z16_23880 Help Entry G4Z16_23880       CDS       T07305                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sbat  Streptomyces bathyalis Pathway sbat01056   Biosynthesis of type II polyketide backbone sbat01100   Metabolic pathways sbat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbat00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     G4Z16_23880    00253 Tetracycline biosynthesis     G4Z16_23880  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sbat01004]     G4Z16_23880    01008 Polyketide biosynthesis proteins [BR:sbat01008]     G4Z16_23880 Lipid biosynthesis proteins [BR:sbat01004]  Polyketide synthase   Component type    G4Z16_23880 Polyketide biosynthesis proteins [BR:sbat01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      G4Z16_23880     Nonaketide PKS      G4Z16_23880     Decaketide PKS      G4Z16_23880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Phage_tail_terminator_4 Motif Other DBs NCBI-ProteinID:  QPP08944 UniProt:  A0A7T1T9S4 LinkDB All DBs Position 5525974..5526228 Genome browser AA seq 84 aa AA seqDB search MTAMTFDELRMMMREAAGEGDGVDLDGDILQTPFAELEFDSLALMEVAARIKQEHGIEIT DEVLGDLKTPQMMIEYVNAQPAVR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccgcgatgaccttcgacgaactgcgcatgatgatgcgcgaggccgcaggcgagggt gacggcgtcgacctcgacggcgacatcctccagacccccttcgcagagctggagttcgac tcgctggctctgatggaggtcgcggcgaggatcaagcaggaacacggcatcgagatcacg gacgaggtcctcggggacctcaagaccccccagatgatgatcgagtacgtcaacgcccag ccggcagtgaggtga

DBGET integrated database retrieval system