Shewanella baltica BA175: Sbal175_3904 Help Entry Sbal175_3904      CDS       T02014                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sbb  Shewanella baltica BA175 Pathway sbb01100   Metabolic pathways sbb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sbal175_3904    00074 Mycolic acid biosynthesis     Sbal175_3904   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sbal175_3904 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEG13126 LinkDB All DBs Position 4616323..4616571 Genome browser AA seq 82 aa AA seqDB search MQNREQILAMLTTILVDEFEIEAEAITPEANLYEELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVNDVVNAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgaacaaatcctcgctatgctgaccactattttagtggacgaattcgaa attgaggccgaggcgattacgcctgaggccaacctgtatgaagagctcgatctcgacagt attgatgccgtcgacttagtgatcaagctgcagcaactgacgggtaaaaagatccaaccc gatgaatttaaatccgttcgcacagtcaacgatgtggttaatgccatcgaaggtttagtt aaagactaa

DBGET integrated database retrieval system