Sphingobium baderi: ATN00_15950 Help Entry ATN00_15950       CDS       T04194                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sbd  Sphingobium baderi Pathway sbd00998   Biosynthesis of various antibiotics sbd01100   Metabolic pathways sbd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ATN00_15950    00074 Mycolic acid biosynthesis     ATN00_15950   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ATN00_15950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALR21566 UniProt:  A0A0S3F1J6 LinkDB All DBs Position 3273745..3274035 Genome browser AA seq 96 aa AA seqDB search MRAEDSQPVDRMDDVDGLTRALLRDVLGLSQERVDAFEVDTPLFGALPELDSMAVAGLLT EMEDRFHILIDDEDIDGDTFETFGTLVAFARMKIGG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcgggcagaagattctcagccggtcgaccggatggacgatgtggatggcctgacgcga gcgctgctgcgcgacgtgctgggcctgtcgcaggaacgggtcgacgctttcgaagtcgat acgccgctgttcggcgcgctgccggaactggattccatggctgtcgcgggcctgctcacc gaaatggaagaccgcttccacatcctgatcgacgatgaggatattgacggcgatacgttc gagacattcggaacgctggtcgccttcgcgcggatgaagatcggcggttaa

DBGET integrated database retrieval system