Salmonella bongori NCTC 12419: SBG_0638 Help Entry SBG_0638          CDS       T01579                                  Name (GenBank) putative membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism sbg  Salmonella bongori NCTC 12419 Pathway sbg00190   Oxidative phosphorylation sbg01100   Metabolic pathways sbg02020   Two-component system Module sbg_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:sbg00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SBG_0638  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SBG_0638 Enzymes [BR:sbg01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      SBG_0638 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  CCC29731 UniProt:  A0A0K0H8M2 LinkDB All DBs Position 725886..725999 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEHVEAGKTGQEES NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgtgcattcgggatcattacc gccctggcgcttgagcacgttgaagcgggtaaaaccggccaggaagaaagctaa

DBGET integrated database retrieval system