Salmonella bongori NCTC 12419: SBG_1034 Help Entry SBG_1034          CDS       T01579                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sbg  Salmonella bongori NCTC 12419 Pathway sbg01100   Metabolic pathways sbg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBG_1034 (acpP)    00074 Mycolic acid biosynthesis     SBG_1034 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBG_1034 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  CCC30130 UniProt:  A0A0K0H9K0 LinkDB All DBs Position 1143036..1143272 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgtcgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system