Salmonella bongori NCTC 12419: SBG_2501 Help Entry SBG_2501          CDS       T01579                                  Symbol sipF Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism sbg  Salmonella bongori NCTC 12419 Pathway sbg01100   Metabolic pathways sbg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBG_2501 (sipF)    00074 Mycolic acid biosynthesis     SBG_2501 (sipF)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBG_2501 (sipF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CCC31557 UniProt:  A0A0K0HDT9 LinkDB All DBs Position complement(2743964..2744212) Genome browser AA seq 82 aa AA seqDB search MNMDIEARVKKVITSCIAVDVHSINGQTHLVEDLYADSLDLIDIVFGLSEEFDISCNEND LPDMTTVADICQVVEKSLLSRG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaatatggatattgaagcaagagttaaaaaagtgattacctcctgtattgccgttgat gttcatagcatcaatggtcagacccatctggttgaggacctgtacgcggactcgctggat ttaattgatattgtgttcggcctcagcgaggaatttgatattagttgtaatgaaaacgat ctcccggatatgacgaccgtggcggatatttgccaggttgtcgaaaagagtcttctgtcc aggggatag

DBGET integrated database retrieval system