Salmonella bongori NCTC 12419: SBG_3459 Help Entry SBG_3459          CDS       T01579                                  Symbol trxA Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism sbg  Salmonella bongori NCTC 12419 Pathway sbg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sbg00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     SBG_3459 (trxA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sbg03110]     SBG_3459 (trxA) Chaperones and folding catalysts [BR:sbg03110]  Protein folding catalysts   Protein disulfide isomerase    SBG_3459 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 TraF Thioredoxin_9 OST3_OST6 AhpC-TSA Redoxin Thioredoxin_3 Glrx-like Thioredoxin_7 Thioredoxin_6 HyaE DUF6568 Motif Other DBs NCBI-ProteinID:  CCC32506 UniProt:  A0A0K0HGI0 LinkDB All DBs Position 3809207..3809536 Genome browser AA seq 109 aa AA seqDB search MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgagcgataaaattattcacctgactgacgatagttttgacacggatgtactcaaagcg gacggggctatcctcgttgatttctgggcagagtggtgcgggccgtgtaaaatgatcgct ccgattctggatgaaatcgctgacgaatatcagggcaaattgaccgttgccaaactgaac attgaccagaaccctggtacggcgcctaaatacggcatccgcggtattccgactctgctg ctgtttaaaaacggcgaagtggcggcaaccaaagtgggcgcattgtctaaaggtcagcta aaagagtttctcgacgccaatctggcgtaa

DBGET integrated database retrieval system