Streptomyces bingchenggensis: SBI_06742 Help Entry SBI_06742         CDS       T01678                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sbh  Streptomyces bingchenggensis Pathway sbh00998   Biosynthesis of various antibiotics sbh01100   Metabolic pathways sbh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBI_06742    00074 Mycolic acid biosynthesis     SBI_06742   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBI_06742 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ADI09862 UniProt:  D7BXW4 LinkDB All DBs Position 8081366..8081617 Genome browser AA seq 83 aa AA seqDB search MAAIVEERQETIKEIVTDILEIDPDEVTETSLFKEEHDADSLRAIEILAALEKEFNVVIP QAQLSRMTNLEGVYEVVSEAAGW NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccgccatcgtcgaagagcgccaggaaacaatcaaggaaatcgtcacggatatcctt gagatagatccggacgaggtcaccgagaccagcctcttcaaggaagaacacgacgcggat tcgctacgggccatcgagattctggcggccctggaaaaggagttcaacgtcgtcatcccg caggcgcagctcagccgcatgaccaacctcgagggtgtctacgaggtcgtctccgaagcg gccggctggtaa

DBGET integrated database retrieval system