Streptomyces bingchenggensis: SBI_06756 Help Entry SBI_06756         CDS       T01678                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sbh  Streptomyces bingchenggensis Pathway sbh00998   Biosynthesis of various antibiotics sbh01100   Metabolic pathways sbh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBI_06756    00074 Mycolic acid biosynthesis     SBI_06756   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBI_06756 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ADI09876 UniProt:  D7BZH1 LinkDB All DBs Position 8094470..8094724 Genome browser AA seq 84 aa AA seqDB search MADTAAALDLEELRAFVADVLDVEEEEVTDDADFVAELGVDSLMALEVMVVLEKKYSVKL QEQEMKEITCLSNVYDLLASKLEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcagacaccgccgccgccctggacctggaggagctgcgcgccttcgtcgccgacgtc ctcgacgtcgaggaggaggaggtcaccgacgacgccgacttcgtggcggagctgggcgtc gactccctcatggccctggaggtcatggtcgtcctggagaagaagtactcggtgaagctc caggagcaggagatgaaggagatcacctgtctcagcaacgtctatgacctgctggcctcg aaactggagaagtga

DBGET integrated database retrieval system