Streptomyces bingchenggensis: SBI_07452 Help Entry SBI_07452         CDS       T01678                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sbh  Streptomyces bingchenggensis Pathway sbh00998   Biosynthesis of various antibiotics sbh01100   Metabolic pathways sbh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBI_07452 (acpP)    00074 Mycolic acid biosynthesis     SBI_07452 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBI_07452 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ADI10572 UniProt:  D7C954 LinkDB All DBs Position complement(8869875..8870123) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPTEDVLLEKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDAADYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgaaggtctcgccgagatcgtcaacgagatcgcc ggtatcccgaccgaggacgtcctgctggagaagtccttcacggacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgccgccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system