Streptomyces bingchenggensis: SBI_07646 Help Entry SBI_07646         CDS       T01678                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sbh  Streptomyces bingchenggensis Pathway sbh00998   Biosynthesis of various antibiotics sbh01100   Metabolic pathways sbh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBI_07646    00074 Mycolic acid biosynthesis     SBI_07646   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBI_07646 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADI10766 UniProt:  D7CB83 LinkDB All DBs Position 9069978..9070250 Genome browser AA seq 90 aa AA seqDB search MTTADLTEEEALSIVAKAAAQVDARLAERTFTLADDIGEIGLDSVATLELIVSIEDQTGL SFDDDVLFGVGTVGDVVELIRGGKPAVREG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgacgaccgccgatctgacggaagaagaagcgctcagcatcgtcgccaaggccgcggcg caggtggacgcccggctggcggagcgtacgttcacgctggcggacgacatcggggagatc ggcctcgactcggtggccacccttgagctgatcgtctccatcgaggaccagaccgggctc agcttcgacgacgacgtgctgttcggggtcggcaccgtaggcgatgtcgtcgagctgatc cggggcggtaagcccgcggtccgggagggctga

DBGET integrated database retrieval system