Sorghum bicolor (sorghum): 8054860 Help Entry 8054860           CDS       T01086                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism sbi  Sorghum bicolor (sorghum) Pathway sbi03030   DNA replication sbi03410   Base excision repair sbi03420   Nucleotide excision repair sbi03430   Mismatch repair sbi03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sbi00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     8054860    03410 Base excision repair     8054860    03420 Nucleotide excision repair     8054860    03430 Mismatch repair     8054860    03440 Homologous recombination     8054860  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sbi03032]     8054860    03400 DNA repair and recombination proteins [BR:sbi03400]     8054860 DNA replication proteins [BR:sbi03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     8054860 DNA repair and recombination proteins [BR:sbi03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       8054860    MMR (mismatch excision repair)     DNA polymerase delta complex      8054860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  8054860 NCBI-ProteinID:  XP_002462682 UniProt:  C5X609 A0A921UUA8 LinkDB All DBs Position 2:complement(65178106..65180887) Genome browser AA seq 131 aa AA seqDB search MSSGGVKDFYRQKKKGGVTKAAASSKKKTQQYTGGASVGAPDTAQTSALVSHGSWDLKDD FGDQEEQLRQFDMDMKFGPCIGVTRLQRWERASAMGLHPPAHLRDLLLHAPSTKNRSDGS PSVECLWEGNV NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgtcgtctggtggtgtgaaagatttttaccggcagaaaaagaaaggaggtgtgaccaag gcagcagcatcttcgaagaagaagacacagcagtacactggtggggcctctgttggcgcc ccagatactgctcagacatcagctctagtttctcatggctcctgggatctcaaagatgat tttggtgatcaagaagagcagctgcgtcagtttgacatggacatgaaatttggcccatgc attggtgttactcggcttcagcgctgggagcgagcctcagccatgggcctccatccacca gctcatctccgggacctcttactgcatgcgccatcaacaaagaatcgcagtgacggtagt ccctctgttgagtgcctttgggagggtaatgtctag

DBGET integrated database retrieval system