Sorghum bicolor (sorghum): 8064446 Help Entry 8064446           CDS       T01086                                  Name (RefSeq) 10 kDa chaperonin, mitochondrial   KO K04078   chaperonin GroES Organism sbi  Sorghum bicolor (sorghum) Brite KEGG Orthology (KO) [BR:sbi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sbi03110]     8064446    03029 Mitochondrial biogenesis [BR:sbi03029]     8064446 Chaperones and folding catalysts [BR:sbi03110]  Heat shock proteins   HSP10    8064446 Mitochondrial biogenesis [BR:sbi03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     8064446 SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-GeneID:  8064446 NCBI-ProteinID:  XP_002461106 UniProt:  C5X3E1 LinkDB All DBs Position 2:74615298..74617261 Genome browser AA seq 98 aa AA seqDB search MAKRLLPSLNRVLVEKLVQPKKTAGGILLPETSKQLNAAKVVAVGPGERDKAGNLIPVAL KEGDTVLLPEYGGTEVKLAADKEYLLFREHDILGTLVD NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaggctgctcccgtcgctgaaccgggtgctggtggagaagctggtgcagccc aagaagaccgcaggcggcatcctcctcccggaaacatccaagcagctgaatgctgctaag gtggtggctgttggccctggtgagcgcgacaaggcaggcaatctgatcccagttgctctg aaggaaggcgacactgttcttctgcctgagtatggtggaactgaagtcaagcttgcggct gataaagagtacctcctcttcagagagcacgacattttgggcacacttgttgactga

DBGET integrated database retrieval system