Sorghum bicolor (sorghum): 8065540 Help Entry 8065540           CDS       T01086                                  Name (RefSeq) rac-like GTP-binding protein 4   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sbi  Sorghum bicolor (sorghum) Pathway sbi04145   Phagosome sbi04148   Efferocytosis sbi04620   Toll-like receptor signaling pathway sbi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sbi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     8065540    04148 Efferocytosis     8065540  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     8065540  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     8065540  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sbi04131]     8065540   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sbi04147]     8065540    04031 GTP-binding proteins [BR:sbi04031]     8065540 Membrane trafficking [BR:sbi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     8065540  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     8065540   Macropinocytosis    Ras GTPases     8065540  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     8065540 Exosome [BR:sbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    8065540   Exosomal proteins of other body fluids (saliva and urine)    8065540   Exosomal proteins of colorectal cancer cells    8065540   Exosomal proteins of bladder cancer cells    8065540 GTP-binding proteins [BR:sbi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     8065540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  8065540 NCBI-ProteinID:  XP_002436763 UniProt:  C5Z7F5 A0A921Q199 LinkDB All DBs Position 10:8651677..8656180 Genome browser AA seq 215 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLAGT KLDLREDKHYLLDHPGAVPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAAIKVVI RPPTKQRERKKKKARRGCSMFCSRIMHTRRLGCFK NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcatccagcgcctcccggttcatcaagtgcgtcacagtgggggacggcgccgtggga aagacctgcatgctcatctgctacaccagcaacaagttccccactgattacatacccact gtcttcgataacttcagtgcaaacgtggtggtcgacggcaccaccgtgaatttgggcctt tgggatactgcagggcaggaagattacaacagattgaggccactgagctaccgcggagca gatgtgttcgtgctcgctttctcgcttgtcagccgagctagctacgagaatgttatgaag aagtggctaccggagcttcagcattatgcaccgggtgtacccatagtgttggctggaact aaattggatcttcgtgaagataagcactacttacttgaccatcctggcgcagtacctgtt actacagcacagggggaggaacttcgcaagcacattggcgcaacttgttacatcgagtgc agctcaaaaactcagcagaatgtgaaagctgtgtttgatgctgccatcaaggtagtaatc cggcctccgaccaagcagcgagaaaggaagaaaaagaaagcacggcgaggatgctcaatg ttttgcagccgtatcatgcacacaaggagactaggatgcttcaagtga

DBGET integrated database retrieval system