Sorghum bicolor (sorghum): 8067502 Help Entry 8067502           CDS       T01086                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sbi  Sorghum bicolor (sorghum) Pathway sbi04145   Phagosome sbi04148   Efferocytosis sbi04620   Toll-like receptor signaling pathway sbi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sbi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     8067502    04148 Efferocytosis     8067502  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     8067502  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     8067502  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sbi04131]     8067502   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sbi04147]     8067502    04031 GTP-binding proteins [BR:sbi04031]     8067502 Membrane trafficking [BR:sbi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     8067502  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     8067502   Macropinocytosis    Ras GTPases     8067502  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     8067502 Exosome [BR:sbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    8067502   Exosomal proteins of other body fluids (saliva and urine)    8067502   Exosomal proteins of colorectal cancer cells    8067502   Exosomal proteins of bladder cancer cells    8067502 GTP-binding proteins [BR:sbi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     8067502 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  8067502 NCBI-ProteinID:  XP_002440067 UniProt:  A0A921QBA7 C5Z0W8 LinkDB All DBs Position 9:54652600..54655371 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPVVLVGTKL DLRDHRAYLADHPGASTITTAQGEELRKQIGAAAYIECSSKTQQNVKSVFDTAIKVVLQP PRRREAMPARKKNRRGSGCSIMNLMCGSTCAA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtcacagtcggggacggcgccgtgggcaagacc tgcatgctcatctgctacaccagcaacaagttccccacggattacatccccacggtgttc gataacttcagcgccaacgtctccgtggatggcaacatcgtcaacctgggcctctgggac actgcggggcaagaggactacagcaggctgcggccactgagctacaggggcgcagatgtg ttcgtgctggctttctccctcatcagcagggccagctatgagaatgttcttaagaagtgg atgccagagcttcgcagatttgcacccaacgttccggttgttcttgttgggaccaagtta gatctccgtgaccacagagcctaccttgctgaccatcctggagcttcgacaatcacaacg gcacagggtgaagagctgaggaagcagattggtgctgcagcttacatcgagtgcagttcc aaaacccagcagaatgtcaagtctgtcttcgatacagccattaaagtggtccttcaaccc ccacggagaagggaggcaatgcctgccaggaagaaaaacaggcgtggctccggatgctct ataatgaaccttatgtgtggcagcacatgtgctgcttag

DBGET integrated database retrieval system