Sorghum bicolor (sorghum): 8067502 Help Entry 8067502           CDS       T01086                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sbi  Sorghum bicolor (sorghum) Pathway sbi04145   Phagosome sbi04148   Efferocytosis sbi04517   IgSF CAM signaling sbi04518   Integrin signaling sbi04620   Toll-like receptor signaling pathway sbi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sbi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     8067502    04518 Integrin signaling     8067502  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     8067502    04148 Efferocytosis     8067502  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     8067502  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     8067502  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sbi04131]     8067502   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sbi04147]     8067502    04031 GTP-binding proteins [BR:sbi04031]     8067502 Membrane trafficking [BR:sbi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     8067502  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     8067502   Macropinocytosis    Ras GTPases     8067502  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     8067502 Exosome [BR:sbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    8067502   Exosomal proteins of other body fluids (saliva and urine)    8067502   Exosomal proteins of colorectal cancer cells    8067502   Exosomal proteins of bladder cancer cells    8067502 GTP-binding proteins [BR:sbi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     8067502 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  8067502 NCBI-ProteinID:  XP_002440067 UniProt:  A0A921QBA7 C5Z0W8 LinkDB All DBs Position 9:54652600..54655371 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADVFVLAFSLISRASYENVLKKWMPELRRFAPNVPVVLVGTKL DLRDHRAYLADHPGASTITTAQGEELRKQIGAAAYIECSSKTQQNVKSVFDTAIKVVLQP PRRREAMPARKKNRRGSGCSIMNLMCGSTCAA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtcacagtcggggacggcgccgtgggcaagacc tgcatgctcatctgctacaccagcaacaagttccccacggattacatccccacggtgttc gataacttcagcgccaacgtctccgtggatggcaacatcgtcaacctgggcctctgggac actgcggggcaagaggactacagcaggctgcggccactgagctacaggggcgcagatgtg ttcgtgctggctttctccctcatcagcagggccagctatgagaatgttcttaagaagtgg atgccagagcttcgcagatttgcacccaacgttccggttgttcttgttgggaccaagtta gatctccgtgaccacagagcctaccttgctgaccatcctggagcttcgacaatcacaacg gcacagggtgaagagctgaggaagcagattggtgctgcagcttacatcgagtgcagttcc aaaacccagcagaatgtcaagtctgtcttcgatacagccattaaagtggtccttcaaccc ccacggagaagggaggcaatgcctgccaggaagaaaaacaggcgtggctccggatgctct ataatgaaccttatgtgtggcagcacatgtgctgcttag

DBGET integrated database retrieval system