Sorghum bicolor (sorghum): 8068254 Help Entry 8068254           CDS       T01086                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sbi  Sorghum bicolor (sorghum) Pathway sbi04145   Phagosome sbi04148   Efferocytosis sbi04620   Toll-like receptor signaling pathway sbi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sbi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     8068254    04148 Efferocytosis     8068254  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     8068254  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     8068254  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sbi04131]     8068254   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sbi04147]     8068254    04031 GTP-binding proteins [BR:sbi04031]     8068254 Membrane trafficking [BR:sbi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     8068254  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     8068254   Macropinocytosis    Ras GTPases     8068254  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     8068254 Exosome [BR:sbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    8068254   Exosomal proteins of other body fluids (saliva and urine)    8068254   Exosomal proteins of colorectal cancer cells    8068254   Exosomal proteins of bladder cancer cells    8068254 GTP-binding proteins [BR:sbi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     8068254 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  8068254 NCBI-ProteinID:  XP_002453210 UniProt:  A0A921R0I2 C5XT00 LinkDB All DBs Position 4:complement(1410026..1413974) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVLQP PKAKKKKKAQRGACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtccaggttcataaagtgcgtcacggtcggggacggcgccgtcggcaagacc tgcatgctcatctcctacacctccaacaccttccccaccgactatgttccgacggtgttt gacaacttcagtgctaatgttgtggttgatggtaacactgtcaacctcggcctctgggac actgcaggtcaagaggattacaacagactgagaccactgagctatcgtggagctgatgtt tttcttctggctttctcactgataagtaaggccagctatgagaatgtttcgaagaagtgg atacctgaactgaagcattatgcacctggtgtgccaataattcttgtaggaacaaagctt gatcttcgagatgacaaacagttctttgtggaccatcctggtgctgtccctatcactact gctcagggagaggagctaagaaagcaaataggcgcaccatactacatcgaatgcagctca aagacccaactaaacgtaaagggtgtgttcgatgcggcgataaaggttgtgctgcagcca ccaaaggcgaagaagaagaaaaaggcgcagaggggggcgtgctccattttgtga

DBGET integrated database retrieval system