Sorghum bicolor (sorghum): 8068254 Help Entry 8068254           CDS       T01086                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sbi  Sorghum bicolor (sorghum) Pathway sbi04145   Phagosome sbi04148   Efferocytosis sbi04517   IgSF CAM signaling sbi04518   Integrin signaling sbi04620   Toll-like receptor signaling pathway sbi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sbi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     8068254    04518 Integrin signaling     8068254  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     8068254    04148 Efferocytosis     8068254  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     8068254  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     8068254  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sbi04131]     8068254   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sbi04147]     8068254    04031 GTP-binding proteins [BR:sbi04031]     8068254 Membrane trafficking [BR:sbi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     8068254  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     8068254   Macropinocytosis    Ras GTPases     8068254  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     8068254 Exosome [BR:sbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    8068254   Exosomal proteins of other body fluids (saliva and urine)    8068254   Exosomal proteins of colorectal cancer cells    8068254   Exosomal proteins of bladder cancer cells    8068254 GTP-binding proteins [BR:sbi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     8068254 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  8068254 NCBI-ProteinID:  XP_002453210 UniProt:  A0A921R0I2 C5XT00 LinkDB All DBs Position 4:complement(1410026..1413974) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVLQP PKAKKKKKAQRGACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtccaggttcataaagtgcgtcacggtcggggacggcgccgtcggcaagacc tgcatgctcatctcctacacctccaacaccttccccaccgactatgttccgacggtgttt gacaacttcagtgctaatgttgtggttgatggtaacactgtcaacctcggcctctgggac actgcaggtcaagaggattacaacagactgagaccactgagctatcgtggagctgatgtt tttcttctggctttctcactgataagtaaggccagctatgagaatgtttcgaagaagtgg atacctgaactgaagcattatgcacctggtgtgccaataattcttgtaggaacaaagctt gatcttcgagatgacaaacagttctttgtggaccatcctggtgctgtccctatcactact gctcagggagaggagctaagaaagcaaataggcgcaccatactacatcgaatgcagctca aagacccaactaaacgtaaagggtgtgttcgatgcggcgataaaggttgtgctgcagcca ccaaaggcgaagaagaagaaaaaggcgcagaggggggcgtgctccattttgtga

DBGET integrated database retrieval system