Sorghum bicolor (sorghum): 8074778 Help Entry 8074778           CDS       T01086                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism sbi  Sorghum bicolor (sorghum) Brite KEGG Orthology (KO) [BR:sbi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:sbi03041]     8074778   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sbi04052]     8074778 Spliceosome [BR:sbi03041]  Complex B   Other components    Complex B specific factors     8074778 Cytokines and neuropeptides [BR:sbi04052]  Neuropeptides   Unclassified    8074778 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Motif Other DBs NCBI-GeneID:  8074778 NCBI-ProteinID:  XP_021315939 LinkDB All DBs Position 4:complement(57182962..57183640) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKRLVAAQTGTRADKIRIQKWYTIYKDHITLADY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtgctgaacgaccggctggggaagaaggtgcgcgtcaagtgcaacgag gacgacacgatcggcgacctgaagcggctggtggcggcgcagacggggacgcgcgccgac aagatccgcatccagaagtggtacaccatctacaaggaccacatcaccctcgccgactac gagatccatgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system