Sorghum bicolor (sorghum): 8075674 Help Entry 8075674           CDS       T01086                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism sbi  Sorghum bicolor (sorghum) Pathway sbi03083   Polycomb repressive complex sbi04120   Ubiquitin mediated proteolysis sbi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sbi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     8075674    04120 Ubiquitin mediated proteolysis     8075674   09126 Chromosome    03083 Polycomb repressive complex     8075674  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sbi04131]     8075674    04121 Ubiquitin system [BR:sbi04121]     8075674    03036 Chromosome and associated proteins [BR:sbi03036]     8075674 Membrane trafficking [BR:sbi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     8075674 Ubiquitin system [BR:sbi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      8075674    Cul7 complex      8075674 Chromosome and associated proteins [BR:sbi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      8075674   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      8075674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Motif Other DBs NCBI-GeneID:  8075674 NCBI-ProteinID:  XP_002444405 UniProt:  A0A921QKU2 C5YLA2 LinkDB All DBs Position 7:56737979..56738719 Genome browser AA seq 168 aa AA seqDB search MAASSEAEKTKKMVTLRSSDSEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKIL AKVIEYCNKHVHAAAAQHAGLAAAAYDGEDLKSWDAEFVKVDQATLFDLILAANYLNIKG LLDLTCQTVADMMKGKTPEEIRETFHIKNDLTEEEEEAIRTENRWAFE NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atggcggcgtcttccgaggctgagaagacgaagaagatggttacgttgaggagctccgac tcggaggagttcgaggtggaggaggcggtggcgatggagtcgcagaccatccgccacatg atcgaggacgactgcgccgacaacggcatcccgctccccaacgtcaactcgaagatcctc gccaaggtcatcgagtactgtaacaagcacgtccacgccgccgcggcgcagcacgccggc ctcgccgctgcagcgtacgacggcgaggacctcaagagctgggacgcggagttcgtcaag gtcgaccaggctacgctcttcgacctcatcctggctgccaactatctgaacatcaaggga ttgctggacctgacctgccagacggtggctgacatgatgaagggcaagactccggaggag atccgcgagacattccacatcaagaacgacctcacggaagaggaggaggaggcgatccgc acggagaaccgatgggccttcgagtga

DBGET integrated database retrieval system