Sorghum bicolor (sorghum): 8081934 Help Entry 8081934           CDS       T01086                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism sbi  Sorghum bicolor (sorghum) Pathway sbi04136   Autophagy - other Brite KEGG Orthology (KO) [BR:sbi00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     8081934  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sbi04131]     8081934    04121 Ubiquitin system [BR:sbi04121]     8081934    03029 Mitochondrial biogenesis [BR:sbi03029]     8081934 Membrane trafficking [BR:sbi04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     8081934 Ubiquitin system [BR:sbi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    8081934 Mitochondrial biogenesis [BR:sbi03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     8081934 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  8081934 NCBI-ProteinID:  XP_002454650 UniProt:  C5XTK4 A0A921UMT7 LinkDB All DBs Position 4:complement(65261341..65263840) Genome browser AA seq 91 aa AA seqDB search MAAEVDQKVVVHVRSTGDAPILKQSKFKISGRDKFLKVIEFLRRQLHQDTLFVYINSAFS PNPDELVIDLYNNFGIDGKLVVNYALSAAWG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggccgcggaggtggatcagaaagtggtggtgcacgtgcggtccacgggtgatgcgccg atcctaaagcaatccaaattcaagatttcaggacgagataagtttttgaaggtcatagag tttcttcgccgacaacttcatcaagatacactgtttgtctatatcaacagtgcattttcg ccaaacccagatgaactggtaattgacttgtataataactttggaattgatgggaagctg gtggtaaattatgctttgtcagcagcatggggctaa

DBGET integrated database retrieval system