Sphingomonas bisphenolicum: SBA_ch1_32730 Help Entry SBA_ch1_32730     CDS       T08354                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sbin  Sphingomonas bisphenolicum Pathway sbin01100   Metabolic pathways sbin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBA_ch1_32730 (acpP)    00074 Mycolic acid biosynthesis     SBA_ch1_32730 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBA_ch1_32730 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  BBF71073 LinkDB All DBs Position 1:complement(3323472..3323705) Genome browser AA seq 77 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIDSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaccgcggatcgcgtaaagaaaatcgtcgtcgagcatctgggcgttgaagcc gaaaaggtgaccgaggacgccagcttcatcgacgatctgggcgcggacagcctggacatc gtcgaactggtgatggcgttcgaagaagaattcggcgtcgaaatccccgacgacgctgcc gagaagatcgcgaccgtcaaggatgcgatcgactatatcgacagcaagcagtaa

DBGET integrated database retrieval system