Sphingomonas bisphenolicum: SBA_pBAR3_1780 Help Entry SBA_pBAR3_1780    CDS       T08354                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sbin  Sphingomonas bisphenolicum Pathway sbin01100   Metabolic pathways sbin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SBA_pBAR3_1780    00074 Mycolic acid biosynthesis     SBA_pBAR3_1780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SBA_pBAR3_1780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBF72611 UniProt:  A0ABN5WK34 LinkDB All DBs Position pBAR3:177355..177504 Genome browser AA seq 49 aa AA seqDB search MEDLGADSLDVVELVMAIEEGFDVQIPDDDAEKIATVRDAVLYIEAAMV NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggaggatctgggtgcggacagtctggatgtcgtcgagcttgtcatggcgatcgaggaa ggcttcgacgtccagattcccgacgatgatgctgagaagatcgcgacggtgagggatgcc gttctctatatcgaagccgcgatggtctga

DBGET integrated database retrieval system