KEGG   Shewanella bicestrii: CF168_21100
Entry
CF168_21100       CDS       T05197                                 
Name
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
sbj  Shewanella bicestrii
Pathway
sbj03030  DNA replication
sbj03430  Mismatch repair
sbj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CF168_21100
   03430 Mismatch repair
    CF168_21100
   03440 Homologous recombination
    CF168_21100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbj03032]
    CF168_21100
   03400 DNA repair and recombination proteins [BR:sbj03400]
    CF168_21100
   03029 Mitochondrial biogenesis [BR:sbj03029]
    CF168_21100
DNA replication proteins [BR:sbj03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CF168_21100
DNA repair and recombination proteins [BR:sbj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     CF168_21100
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CF168_21100
Mitochondrial biogenesis [BR:sbj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    CF168_21100
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: ASK71389
UniProt: A0A220UTC1
LinkDB
Position
pSHE-CTX-M:25634..26164
AA seq 176 aa
MMSKGVNKVILVGNLGSDPEIRYMPSGTAVANFNVATTDTWRDKQSGEQREHTEWHRIVL
KGRLAEVAGEYLKKGSQVYLEGSNRTRKWTDSQQIERYTTEVHCVEMQMLGGRGNAPQDN
SQRAAPQKGQRTGAGTQSAPVQQSAPQGGMGGGYGPAPDGWDDDIPFMRLHHLAGG
NT seq 531 nt   +upstreamnt  +downstreamnt
atgatgtctaaaggcgtcaacaaagtaattctggtcggtaatctcggttctgacccggaa
attcgctacatgccaagcggaactgccgttgccaacttcaacgttgcaacaacggatacg
tggcgcgataagcagtctggcgagcaaagagagcatactgagtggcaccgtattgtgctt
aaaggtcgtttggcagaagtcgctggtgagtacctgaaaaagggctcccaagtctatctc
gaagggagcaaccgcacccggaagtggactgacagccaacaaatcgagcgctacaccacc
gaagtacactgcgttgaaatgcagatgcttggtggtcgtggaaatgcacctcaggacaac
tctcaacgtgcagcgccccaaaaagggcaacgtacaggagccggtacgcaatctgctcct
gtgcagcaatcagcaccgcaaggtggtatgggcggaggctatggtcccgctcctgatggc
tgggatgatgacatcccgttcatgcggctgcaccacttggctggcgggtaa

DBGET integrated database retrieval system