Shewanella benthica: SHEWBE_2117 Help Entry SHEWBE_2117       CDS       T06707                                  Symbol hupB Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism sbk  Shewanella benthica Brite KEGG Orthology (KO) [BR:sbk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sbk03032]     SHEWBE_2117 (hupB)    03036 Chromosome and associated proteins [BR:sbk03036]     SHEWBE_2117 (hupB)    03400 DNA repair and recombination proteins [BR:sbk03400]     SHEWBE_2117 (hupB) DNA replication proteins [BR:sbk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SHEWBE_2117 (hupB) Chromosome and associated proteins [BR:sbk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SHEWBE_2117 (hupB) DNA repair and recombination proteins [BR:sbk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SHEWBE_2117 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  SQH76083 UniProt:  A0A330M3S2 LinkDB All DBs Position SHEWBE:1980530..1980802 Genome browser AA seq 90 aa AA seqDB search MNKSELIEKIATGADISKAAAGRALDSFIGAVTDGLKNGDKISLVGFGTFEVRQRAERTG RNPQTGAEIKIAAANIPAFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatctgaactaatcgagaaaatcgctactggtgctgacatttctaaagcggct gctggccgtgcattagattctttcatcggcgcagtcactgacggccttaaaaatggcgat aagatttctcttgttggttttggtacttttgaagtgcgtcaacgtgctgagcgtactggt cgcaacccacagacgggtgcagagattaagattgctgcagcaaatattcctgctttcaaa gcaggtaaagctctgaaagacgctgtgaactaa

DBGET integrated database retrieval system