Shewanella baltica OS155: Sbal_2977 Help Entry Sbal_2977         CDS       T00478                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism sbl  Shewanella baltica OS155 Pathway sbl00190   Oxidative phosphorylation sbl01100   Metabolic pathways sbl02020   Two-component system Module sbl_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:sbl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Sbal_2977  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Sbal_2977 Enzymes [BR:sbl01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Sbal_2977 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABN62459 UniProt:  A3D6U6 LinkDB All DBs Position complement(3496841..3496957) Genome browser AA seq 38 aa AA seqDB search MWYFTWILGVLLACSFGIINALWLENTENMDRSADDAE NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttacgtggatattaggggttttgttggcctgttctttcgggattatcaat gccctgtggcttgagaatactgagaacatggacagatcggcagatgatgccgagtaa

DBGET integrated database retrieval system