Shewanella baltica OS185: Shew185_3767 Help Entry Shew185_3767      CDS       T00571                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism sbm  Shewanella baltica OS185 Pathway sbm02024   Quorum sensing sbm03018   RNA degradation Brite KEGG Orthology (KO) [BR:sbm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Shew185_3767  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Shew185_3767  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sbm03019]     Shew185_3767    03036 Chromosome and associated proteins [BR:sbm03036]     Shew185_3767 Messenger RNA biogenesis [BR:sbm03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Shew185_3767 Chromosome and associated proteins [BR:sbm03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Shew185_3767 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ABS09891 UniProt:  A6WSV2 LinkDB All DBs Position complement(4476123..4476395) Genome browser AA seq 90 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPARPFNVTGHQNAQGGYGAQDDAPSGE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccatttttgaacgcattgcgtcgcgagcgcgtt cctgtatcaatttacttggtgaacggcattaaactccaaggacaggtagagtcgtttgat caatttgtcattctgttgaaaaacacagtgagccaaatggtttataaacacgctatttct actgtcgtgccagcacgcccattcaacgtcactggtcaccaaaatgcccaaggcggatat ggtgctcaagatgatgcgcctagtggcgaataa

DBGET integrated database retrieval system