Shigella boydii Sb227 (serotype 4): SBO_0301 Help Entry SBO_0301          CDS       T00301                                  Symbol yajC Name (GenBank) conserved hypothetical protein   KO K03210   preprotein translocase subunit YajC Organism sbo  Shigella boydii Sb227 (serotype 4) Pathway sbo02024   Quorum sensing sbo03060   Protein export sbo03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sbo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SBO_0301 (yajC)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SBO_0301 (yajC)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SBO_0301 (yajC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sbo02044]     SBO_0301 (yajC) Secretion system [BR:sbo02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    SBO_0301 (yajC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YajC MreC Orf78 MlaD TM_ErbB1 PIRT DUF6097 Motif Other DBs NCBI-ProteinID:  ABB65014 ShiBASE_China:  SBO0301 UniProt:  Q325J4 LinkDB All DBs Position 316258..316590 Genome browser AA seq 110 aa AA seqDB search MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGD EVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgagcttttttatttctgatgcggtagcggcaacgggtgcaccggcgcaaggtagcccg atgtctttgattttgatgctggtggtattcggtctgattttctatttcatgatcctgcgt ccacagcagaagcgcaccaaagaacacaaaaagctgatggactccattgccaaaggtgat gaagttctgacgaacggtggcctggttggtcgcgtaaccaaagtagcggaaaacggctac attgctatcgcgctgaatgacaccactgaagtagttattaaacgtgacttcgtagctgcc gtcctgccgaaaggcaccatgaaggcgctgtaa

DBGET integrated database retrieval system