Shigella boydii Sb227 (serotype 4): SBO_0491 Help Entry SBO_0491          CDS       T00301                                  Symbol ybeC Name (GenBank) conserved hypothetical protein   KO K03425   sec-independent protein translocase protein TatE Organism sbo  Shigella boydii Sb227 (serotype 4) Pathway sbo03060   Protein export sbo03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sbo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SBO_0491 (ybeC)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SBO_0491 (ybeC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sbo02044]     SBO_0491 (ybeC) Secretion system [BR:sbo02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SBO_0491 (ybeC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ABB65192 ShiBASE_China:  SBO0491 UniProt:  Q324R6 LinkDB All DBs Position 509357..509560 Genome browser AA seq 67 aa AA seqDB search MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMNDDDAAAKKGADVDLQA EKLSHKE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggtgagattagtattaccaaactgctggtagttgcggcgctggtcgttctgctgttt gggactaagaagttacgtacgctgggcggagaccttggagcggccattaaagggttcaag aaggcgatgaatgatgatgatgctgcggcgaaaaaaggcgcagacgttgatcttcaggct gaaaagctctctcataaagagtga

DBGET integrated database retrieval system