Shigella boydii Sb227 (serotype 4): SBO_3850 Help Entry SBO_3850          CDS       T00301                                  Name (GenBank) conserved hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism sbo  Shigella boydii Sb227 (serotype 4) Pathway sbo03060   Protein export sbo03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sbo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SBO_3850  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SBO_3850  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sbo02044]     SBO_3850 Secretion system [BR:sbo02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SBO_3850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4834 Motif Other DBs NCBI-ProteinID:  ABB68308 ShiBASE_China:  SBO3850 UniProt:  Q31UF0 LinkDB All DBs Position 3875339..3875650 Genome browser AA seq 103 aa AA seqDB search MRLCLIIIYHRGTCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDD EPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcggctttgtttaatcatcatctaccacagaggaacatgtatgggtggtatcagtatt tggcagttattgattattgccgtcatcgttgtactgctttttggcaccaaaaagctcggc tccatcggttccgatcttggtgcgtcgatcaaaggctttaaaaaagcaatgagcgatgat gaaccaaagcaggataaaaccagtcaggatgctgattttactgcgaaaactatcgccgat aagcaggcggatacgaatcaggaacaggctaaaacagaagacgcgaagcgccacgataaa gagcaggtgtaa

DBGET integrated database retrieval system