Shewanella baltica OS223: Sbal223_0350 Help Entry Sbal223_0350      CDS       T00803                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism sbp  Shewanella baltica OS223 Pathway sbp01100   Metabolic pathways sbp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sbp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sbal223_0350    00074 Mycolic acid biosynthesis     Sbal223_0350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sbal223_0350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACK44885 LinkDB All DBs Position complement(391285..391539) Genome browser AA seq 84 aa AA seqDB search MNLNNEIKQLIIDCLDLEDVSIDDIETDAPLFGEGLGLDSIDALELGLAIKKKFDVKIEA NSDATKAHFHSVASLASFIESQRP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacttaaacaatgaaataaagcagttaatcatcgactgtctcgatcttgaagacgtc agtattgatgatattgaaaccgatgcgccgctctttggcgaaggtctaggcttagattca atcgacgccctcgaactcggcttagccatcaagaaaaaatttgatgtcaaaatcgaggct aattcggatgccactaaggcccattttcacagtgttgccagcttagctagctttatcgaa tcacagcgtccatag

DBGET integrated database retrieval system