KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038546
Entry
101038546         CDS       T04350                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04114  Oocyte meiosis
sbq04140  Autophagy - animal
sbq04148  Efferocytosis
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04218  Cellular senescence
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04350  TGF-beta signaling pathway
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04540  Gap junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04722  Neurotrophin signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04930  Type II diabetes mellitus
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq05010  Alzheimer disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05034  Alcoholism
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05207  Chemical carcinogenesis - receptor activation
sbq05208  Chemical carcinogenesis - reactive oxygen species
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101038546 (MAPK3)
   04012 ErbB signaling pathway
    101038546 (MAPK3)
   04014 Ras signaling pathway
    101038546 (MAPK3)
   04015 Rap1 signaling pathway
    101038546 (MAPK3)
   04350 TGF-beta signaling pathway
    101038546 (MAPK3)
   04370 VEGF signaling pathway
    101038546 (MAPK3)
   04371 Apelin signaling pathway
    101038546 (MAPK3)
   04668 TNF signaling pathway
    101038546 (MAPK3)
   04066 HIF-1 signaling pathway
    101038546 (MAPK3)
   04068 FoxO signaling pathway
    101038546 (MAPK3)
   04072 Phospholipase D signaling pathway
    101038546 (MAPK3)
   04071 Sphingolipid signaling pathway
    101038546 (MAPK3)
   04024 cAMP signaling pathway
    101038546 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101038546 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101038546 (MAPK3)
   04150 mTOR signaling pathway
    101038546 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101038546 (MAPK3)
   04148 Efferocytosis
    101038546 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101038546 (MAPK3)
   04210 Apoptosis
    101038546 (MAPK3)
   04218 Cellular senescence
    101038546 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101038546 (MAPK3)
   04520 Adherens junction
    101038546 (MAPK3)
   04540 Gap junction
    101038546 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101038546 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101038546 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101038546 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101038546 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101038546 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101038546 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101038546 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101038546 (MAPK3)
   04660 T cell receptor signaling pathway
    101038546 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101038546 (MAPK3)
   04659 Th17 cell differentiation
    101038546 (MAPK3)
   04657 IL-17 signaling pathway
    101038546 (MAPK3)
   04662 B cell receptor signaling pathway
    101038546 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101038546 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101038546 (MAPK3)
   04062 Chemokine signaling pathway
    101038546 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101038546 (MAPK3)
   04929 GnRH secretion
    101038546 (MAPK3)
   04912 GnRH signaling pathway
    101038546 (MAPK3)
   04915 Estrogen signaling pathway
    101038546 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101038546 (MAPK3)
   04917 Prolactin signaling pathway
    101038546 (MAPK3)
   04921 Oxytocin signaling pathway
    101038546 (MAPK3)
   04926 Relaxin signaling pathway
    101038546 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101038546 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101038546 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101038546 (MAPK3)
   04916 Melanogenesis
    101038546 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101038546 (MAPK3)
   04270 Vascular smooth muscle contraction
    101038546 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101038546 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101038546 (MAPK3)
   04725 Cholinergic synapse
    101038546 (MAPK3)
   04726 Serotonergic synapse
    101038546 (MAPK3)
   04720 Long-term potentiation
    101038546 (MAPK3)
   04730 Long-term depression
    101038546 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101038546 (MAPK3)
   04722 Neurotrophin signaling pathway
    101038546 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101038546 (MAPK3)
   04380 Osteoclast differentiation
    101038546 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101038546 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038546 (MAPK3)
   05206 MicroRNAs in cancer
    101038546 (MAPK3)
   05205 Proteoglycans in cancer
    101038546 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101038546 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101038546 (MAPK3)
   05203 Viral carcinogenesis
    101038546 (MAPK3)
   05230 Central carbon metabolism in cancer
    101038546 (MAPK3)
   05231 Choline metabolism in cancer
    101038546 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101038546 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101038546 (MAPK3)
   05212 Pancreatic cancer
    101038546 (MAPK3)
   05225 Hepatocellular carcinoma
    101038546 (MAPK3)
   05226 Gastric cancer
    101038546 (MAPK3)
   05214 Glioma
    101038546 (MAPK3)
   05216 Thyroid cancer
    101038546 (MAPK3)
   05221 Acute myeloid leukemia
    101038546 (MAPK3)
   05220 Chronic myeloid leukemia
    101038546 (MAPK3)
   05218 Melanoma
    101038546 (MAPK3)
   05211 Renal cell carcinoma
    101038546 (MAPK3)
   05219 Bladder cancer
    101038546 (MAPK3)
   05215 Prostate cancer
    101038546 (MAPK3)
   05213 Endometrial cancer
    101038546 (MAPK3)
   05224 Breast cancer
    101038546 (MAPK3)
   05223 Non-small cell lung cancer
    101038546 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101038546 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101038546 (MAPK3)
   05161 Hepatitis B
    101038546 (MAPK3)
   05160 Hepatitis C
    101038546 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101038546 (MAPK3)
   05164 Influenza A
    101038546 (MAPK3)
   05163 Human cytomegalovirus infection
    101038546 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101038546 (MAPK3)
   05165 Human papillomavirus infection
    101038546 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101038546 (MAPK3)
   05135 Yersinia infection
    101038546 (MAPK3)
   05133 Pertussis
    101038546 (MAPK3)
   05152 Tuberculosis
    101038546 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101038546 (MAPK3)
   05140 Leishmaniasis
    101038546 (MAPK3)
   05142 Chagas disease
    101038546 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101038546 (MAPK3)
   05020 Prion disease
    101038546 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101038546 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101038546 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101038546 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101038546 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101038546 (MAPK3)
   04934 Cushing syndrome
    101038546 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101038546 (MAPK3)
   01524 Platinum drug resistance
    101038546 (MAPK3)
   01522 Endocrine resistance
    101038546 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101038546 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101038546 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101038546 (MAPK3)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101038546 (MAPK3)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101038546 (MAPK3)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101038546 (MAPK3)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101038546 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 101038546
NCBI-ProteinID: XP_010339013
LinkDB
Position
Unknown
AA seq 265 aa
MRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAK
LFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDD
LPKERLKELIFQETARFQPGALEAP
NT seq 798 nt   +upstreamnt  +downstreamnt
atgagggatgtctacattgtgcaggacctaatggagactgacctgtacaagttgcttaaa
agccagcagctgagcaatgaccacatctgctacttcctctaccagatcctgcggggcctc
aagtacatccactctgccaacgtcctccaccgggatctaaagccctccaacctgctcatc
aacaccacttgcgaccttaagatctgcgatttcggcctggctcggattgctgatcctgag
cacgaccacaccggcttcctgacagagtatgtggctacacgctggtaccgggccccagag
atcatgctgaactccaagggctataccaagtccatcgacatctggtctgtgggctgcatt
ctggctgagatgctatccaaccggcccatcttccctggcaagcactacctggatcagctc
aaccacattctgggcatcctgggctccccatcccaggaggacctgaattgcatcatcaac
atgaaggcccgaaactacctacagtctctgccctccaagaccaaggtggcctgggccaag
cttttccccaaatcagactccaaagcccttgacctgctggaccggatgctaacctttaac
cccaacaaacggatcacagtggaggaagcactggcccacccctacctggagcagtactat
gacccaacggatgagccagtggccgaggagcccttcaccttcgacatggagctggatgac
ctacccaaggagcggctgaaggagctcatcttccaggagacagcacgcttccagcctggg
gcgctggaggccccctaa

DBGET integrated database retrieval system