KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104650707
Entry
104650707         CDS       T04350                                 
Symbol
TP53AIP1
Name
(RefSeq) p53-regulated apoptosis-inducing protein 1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104650707 (TP53AIP1)
   04115 p53 signaling pathway
    104650707 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 104650707
NCBI-ProteinID: XP_010332967
LinkDB
Position
Unknown
AA seq 82 aa
MGSSPKVSFRSAQASGGRARRQGLGWGDQSPALPVVATGRLCSHRGADIPGFQTGQDSVT
ASGSSRLREDCPQPRALEGAGN
NT seq 249 nt   +upstreamnt  +downstreamnt
atggggtcttcccctaaggtgagcttcagatctgctcaagcttccggtggtagggccagg
aggcagggcctgggctggggagaccagagccccgcattgcctgtcgtggccacgggcaga
ctttgctctcaccgtggtgctgacatcccaggttttcagactggccaggactcagtgaca
gcatctgggtcctcgaggctgcgtgaggactgtccccagcccagggcactggaaggagct
gggaactga

DBGET integrated database retrieval system