Fretibacterium fastidiosum: SY1_19560 Help Entry SY1_19560         CDS       T02602                                  Name (GenBank) bacterial nucleoid protein Hbs   KO K03530   DNA-binding protein HU-beta Organism sbr  Fretibacterium fastidiosum Brite KEGG Orthology (KO) [BR:sbr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sbr03032]     SY1_19560    03036 Chromosome and associated proteins [BR:sbr03036]     SY1_19560    03400 DNA repair and recombination proteins [BR:sbr03400]     SY1_19560 DNA replication proteins [BR:sbr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SY1_19560 Chromosome and associated proteins [BR:sbr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SY1_19560 DNA repair and recombination proteins [BR:sbr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SY1_19560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_euk_1 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  CBL28783 UniProt:  A0AB94IY73 LinkDB All DBs Position 2165246..2165548 Genome browser AA seq 100 aa AA seqDB search MTKAELIDAIAEKLLLKKKDVVPVVEEVFASIEGALSRGEKCTFVGFGVFEVKERAAREG RNPQDPTKVVKIPAKKVPVFRPGKDLKEKVLAIKGKKKAK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaccaaagcggaacttattgatgcgattgcggagaagcttcttctgaagaagaaggac gtcgtccccgtcgtggaggaagtgtttgcttccatcgaaggcgctctttccagaggtgag aagtgcaccttcgtggggtttggcgtcttcgaggtgaaggagcgcgcggcgcgcgagggc cgcaaccctcaggatcccaccaaggtcgtcaagatccccgccaagaaggtgcccgtcttc cgccccggcaaggatctcaaggagaaagttcttgcaatcaagggcaagaaaaaggcgaag tag

DBGET integrated database retrieval system